Search term Cell Based Assay Kit has been found in the following products: 26

Cell Based Assay Kit

LucyQ Gaussia Luciferase Assay Kit, L0011

  • One Step Assay
  • Stable Luminescent Signal
  • Low Background
  • High Signal to Noise Ratio
Collapse Store at -20℃
Cat No Size Price
L0011-010 100 rxns $ 177.00 Add to cart
L0011-100 1000 rxns $ 662.00 Add to cart
GLuc-M2 sequence KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKL
PLEVLKELEANARKAGCTRGCLICLSHIKCTPKMK
KFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFK
DLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLL
KKWLPQRCATFASKIQGQVDKIKGAGGDGSLSTPP
TPSPSTPPTGLNDIFEAQKIEWHE
Gluc-M2 For optimal results and a long lasting glow kinetic please use following Gaussia-M2 sequence
(Welsh et al. , Multiply mutated Gaussia luciferases provide prolonged and intense bioluminescence,
Biochemical and Biophysical Research Communications 389 (2009) 563–568)
LucyQ Gaussia Luciferase Assay Kit contains reagents for measuring Gaussia luciferase activity in mammalian cell culture media and lysates. When used with Gaussia Vectors, the kit provides an extremely sensitive bioluminescent reporter assay system for secreted or intracellular detection of luciferase activity with extended signal stability. The light output generated by the luciferase reaction can be correlated to the amount of luciferase protein produced, which in turn is proportional to the activity of the promoter driving the luciferase expression. The kit can be used to detect the activity of any Gaussia luciferases or derivatives that use coelenterazine as a substrate.